GHRH receptor comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2025-11-15. Numbers and descriptions here follow the published literature rather than marketing material.
Two forms circulate under the CJC-1295 name, and they differ by a single appended group. The version without a drug affinity complex carries four substitutions along the peptide chain, including a D-alanine near the amino terminus and replacements at three other positions. These changes block the enzyme dipeptidyl peptidase IV and remove a methionine residue that is prone to oxidation. The modified fragment is frequently labeled MOD GRF 1-29. Naming conventions are inconsistent across informal sources, which is a common source of confusion.
The second form adds a maleimide-bearing linker to the lysine at the carboxyl end. This group reacts with cysteine-34 on circulating serum albumin, forming a covalent bond that keeps the peptide in the bloodstream for far longer. ConjuChem developed the molecule as a way to extend the action of a peptide without frequent administration. The albumin attachment is the defining structural feature of the drug affinity complex version. Whether continuous exposure produces effects distinct from shorter pulses remains an unresolved research question.
The albumin-binding version stays in circulation for days, because covalent attachment to serum albumin shields the peptide from rapid filtration and degradation. Reported half-lives for this form fall in the range of several days. The version without the linker is cleared in minutes, with estimates often near thirty minutes in animal work. These figures come from small studies and vary with assay method, species, and route, so they are best read as approximate rather than fixed constants.
Studies in this area generally track growth hormone pulses, insulin-like growth factor 1 concentrations, and occasionally body composition endpoints. Most published human data come from early, small trials, and questions about long-term effects remain open. Whether repeated exposure alters pituitary responsiveness over time is not settled. Analytical work relies on immunoassays for the hormones and on mass spectrometry for the peptide itself, because the two measurements answer different questions.
| Property | Value | Notes |
|---|---|---|
| Target receptor | GHRH receptor (GHRHR) | Expressed on pituitary somatotrophs |
| Primary action | Stimulates growth hormone release | Amplifies pulse size |
| Half-life, albumin-binding form | Several days as reported | Slow release from albumin complex |
| Half-life, unmodified analog | About 30 minutes in animal estimates | Cleared by proteases and filtration |
| Common analytical approach | LC-MS/MS for peptide, immunoassay for hormones | Methods answer different questions |
Reports on this compound commonly follow serum growth hormone and insulin-like growth factor 1 across defined time windows. Protocols differ in sampling frequency, assay platform, and participant characteristics, which makes direct comparison between publications difficult. Some work focuses on pulsatile release patterns instead of average concentrations. Whether repeated exposure alters endogenous hormone rhythms over long periods remains an open question, and the formal literature is thinner than the volume of informal commentary implies.
Once in circulation, the peptide binds the growth hormone-releasing hormone receptor displayed on pituitary somatotroph cells. Receptor activation couples to Gs proteins, elevates intracellular cyclic AMP, and drives protein kinase A signaling inside the cell. That cascade increases discharge of growth hormone into the bloodstream. The analog therefore operates through a receptor pathway that already exists for the body's own releasing hormone, rather than through an engineered artificial target.
Clearance profiles diverge sharply between the two versions. The albumin-binding molecule stays in plasma for several days, whereas the unmodified analog is largely gone within about half an hour in reported work. Cleavage by dipeptidyl peptidase IV is a major contributor to the short life of the unmodified sequence. These gaps mean the two versions cannot be substituted for each other in study design or in reading results side by side.
Receptor level activity follows the canonical GHRH pathway. The peptide binds the GHRH receptor, a class B G protein coupled receptor on somatotroph cells of the anterior pituitary. Binding raises intracellular cyclic AMP, which promotes calcium entry and the release of growth hormone into the bloodstream. Because the molecule acts at the same receptor as the endogenous hormone, its effect is superimposed on the natural pulsatile rhythm rather than replacing it. Whether sustained receptor occupation leads to desensitization is not fully settled.
CJC-1295 belongs to a class of synthetic peptides modeled on growth hormone releasing hormone, a forty-four amino acid signal produced by the hypothalamus. The compound is built from the first twenty-nine residues of the natural sequence, with four substitutions introduced at positions 2, 8, 15 and 27. These changes were designed to slow enzymatic breakdown while preserving receptor activation. The result is a peptide that is shorter than native GHRH and considerably more resistant to ordinary clearance pathways in circulation.
Enzymatic protection is a separate mechanism from plasma protein binding. The four substitutions in the backbone reduce recognition by dipeptidyl peptidase IV, which normally cleaves the natural hormone within minutes. Without the reactive group, this resistance still yields only a short window of activity, generally reported in the range of tens of minutes. With it, reported half-lives in early human work extended to several days. The size of that gap is the main practical distinction between the two materials.
Both forms act at the pituitary receptor for growth hormone-releasing hormone and increase growth hormone output, which in turn raises insulin-like growth factor 1. A long-acting analog produces sustained rather than pulsatile stimulation, and the physiological consequences of that pattern are not fully settled. Published human data on the extended form remain limited, and much of what circulates in discussion traces to early company reports rather than independent replication. How sustained exposure affects normal feedback remains an open question.
The distinguishing feature of the DAC form is a maleimide-containing group that reacts with the free thiol of cysteine-34 on human serum albumin. This reaction forms a covalent bond without enzymatic assistance, and it takes place after the peptide enters the bloodstream. Because albumin is abundant and long-lived, the attached peptide is carried through circulation far longer than an unmodified fragment would survive. The chemistry is a deliberate pharmacokinetic strategy rather than a change to receptor activity.
In 1939, at the Sir William Dunn School of Pathology at the University of Oxford, Ernst Boris Chain drew the attention of the professor in charge of the school, the Australian scientist Howard Florey, to Fleming's largely forgotten 1929 paper. They decided that the study of antibacterial substances produced by micro-organisms might be a fruitful avenue of research. Florey led an interdisciplinary research team that included Edward Abraham, Mary Ethel Florey, Arthur Duncan Gardner, Norman Heatley, Margaret Jennings, Jean Orr-Ewing and Gordon Sanders. Each member of the team tackled a particular aspect of the problem in their area of expertise, with simultaneous research along different lines building up a complete picture. This sort of collaboration was practically unknown in the United Kingdom at the time. Three sources were initially chosen for investigation: Bacillus subtilis, Trueperella pyogenes and penicillin. "[The possibility] that penicillin could have practical use in clinical medicine", Chain later recalled, "did not enter our minds when we started our work on penicillin." The broad subject area was deliberately chosen as one requiring long-term funding. Florey approached the Medical Research Council (MRC) for support in September 1939. The secretary of the council, Edward Mellanby authorized the project, allocating £250 (equivalent to £14,000 in 2025) to launch the project, with £300 for salaries (equivalent to £17,000 in 2025) and £100 for expenses (equivalent to £6,000 in 2025) per annum for three years.
=== Rock Bottom Restaurant Breweries === The company operates 16 breweries under the name Rock Bottom Restaurant & Brewery. These breweries are located in several states, with five restaurants in Colorado, five in Illinois and one restaurant each in California, Florida, Maryland, Massachusetts, Minnesota and Virginia. The store was renamed Rock Bottom after someone pointed out that they were "building at the bottom of the rock," which was Prudential's slogan at the time. In 2000, the Boston-based Brew Moon Enterprises Inc. filed for bankruptcy and sold four of its five restaurant-microbreweries to Rock Bottom. In 2009, the La Jolla location in San Diego won a medal at the Great American Beer Festival, and in 2012 they medaled at the World Beer Cup. Rock Bottom Restaurants won Brewpub Group Brewer of the Year award at the 2013 Great American Beer Festival (GABF).
==== The shooting of 50 Cent ==== On May 24, 2000, Jackson was shot nine times outside his grandmother's house in connection with a failed robbery attempt. Jackson managed to survive the shooting, though he spent 13 days recovering in the hospital. Adding to existing tension, the attack was reportedly connected to Queens drug lord Kenneth McGriff, who was a known affiliate of Murder Inc. Records. The controversy stemmed from 50 Cent's song "Ghetto Qur'an (Forgive Me)" which had leaked in the spring of 2000. The lyrics directly attacked McGriff and his control over the drug trade in Queens during the 1980s, likely instigating into his own conflict with 50 Cent, culminating in the shooting. Following the attack, problems continued to arise for 50 Cent while he was still hospitalized. The wake of the shooting had cast a negative image for 50 Cent and G-Unit, Columbia Records ultimately chose to drop Jackson and several high-profile labels around New York reportedly blacklisted G-Unit due to the shooting." During this time, Ja Rule had obtained international success as his albums Rule 3:36 and Pain Is Love found widespread commercial success by the beginning of 2002.
Phytoplankton, also known as microscopic algae. Free-floating; drifting with water currents. Periphyton - a microphyte that lives and grows on the surface of rooted aquatic plants. Benthic algae - relatively immobile algae that inhabit the submerged substrate surface of freshwater on mud, stones, or other relatively stable material. Algae may be single celled such as diatoms or Desmids, or multi-celled such as Spirogyra or Cladophora. A few such as some of the diatoms have limited abilities to move over their substrate.
Sources: en.wikipedia.org
=== Eid al-Fitr ceasefire (19–24 March) === On 18 March, Pakistan and Afghanistan both announced that they would observe a "temporary pause" in hostilities during the Islamic holiday of Eid al-Fitr, on the request of Saudi Arabia, Qatar, and Turkey. Pakistan's information minister said the ceasefire would run from midnight on 19 March to midnight on 24 March. On 19 March, Taliban claimed that despite the ceasefire Pakistan conducted 72 mortar attacks in Kunar province firing 25 artillery shells in Nari District only, and that two civilians were killed in shelling in Nuristan Province. On the Pakistani side meanwhile, a civilian was killed and three wounded in an Afghan mortar attack on Kurram District. On 22 March, Taliban claimed that Pakistani artillery strikes in Kunar killed a person and wounded another, and also claimed that Pakistani forces attacked a vehicle in Paktia province causing no casualties. Pakistani forces killed two TTP insurgents in an attempted attack on an under-construction Police Station in Kurram District. On 23 March, TTP militants kidnapped six people from Orakzai District.
The supernatant contains a mitogenic factor, a mitosis promoting factor, that is characterized heat and trypsin sensitivity, both of which characterize it as a peptide. Treatment of Schwann cells with the collected supernatant shows that it is a mitogenic factor and thus plays an important role in the proliferation of Schwann cells. Macrophages are also involved in the secretion factors that promote nerve regeneration. Macrophages secrete not only interleukin-1, a cytokine that induces expression of nerve growth factor (NGF) in Schwann cells but also an interleukin-1 receptor antagonist (IL-1ra). Expression of IL-1ra in mice with transected sciatic nerves via implantation of a tube releasing IL-1ra showed the regrowth of fewer myelinated and unmyelinated axons. Macrophage secretion of interleukin-1 is involved in stimulation of nerve regeneration.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
Nicolas Steno rejected Paracelsus's proposed organic origin for crystals. Steno first observed the law of constancy of interfacial angles when studying quartz crystals (De solido intra solidum naturaliter contento, Florence, 1669), and noted that, although the crystals of a substance differed in appearance from one to another, the angles between corresponding faces were always the same. Steno's work can be considered as the beginning of crystallography as an independent discipline. In 1678 Christiaan Huygens proposed a structural explanation of the double refraction of calcite based on ellipsoidal atoms. Huygens discovered the polarization of light by Iceland spar, a transparent form of calcite, and published his results in his Traité de la Lumière. Domenico Guglielmini's publications of 1688 (Riflessioni filosofiche dedotte dalle figure de Sali) and 1705 (De salibus dissertatio epistolaris physico-medico-mechanica) concluded that the earliest forms (he noted cube, rhombohedral parallelepiped, hexagonal prism, and octahedron) of various salt crystals are characteristic of each substance, are identical in form, indivisible, and have faces with identical inclinations to each other.
=== 20 March === The European Union announced that it will be sending a million rounds of shells to Ukraine over the next 12 months. The United States approved a $350 million military aid package for Ukraine. The package includes ammunition for HIMARS rocket launchers, ammunition for Bradley Fighting Vehicles, HARM missiles, anti-tank weapons, riverine boats, and other equipment.
Sources: en.wikipedia.org
Reported values cluster in the range of several days, reflecting slow release from the albumin complex. Estimates differ across species and assay platforms. The figure describes circulation time in study settings rather than a fixed property.
Typical endpoints include growth hormone pulse frequency and amplitude, together with insulin-like growth factor 1 concentration. Some protocols add body composition or metabolic markers. Interpretation depends on baseline hormonal status, which varies widely between individuals.
Most human data come from small, early-stage studies, and independent replication is limited. Short-term effects on growth hormone release are documented; longer-term outcomes are not well characterized. Open questions include changes in pituitary responsiveness after repeated exposure.
It acts on the growth hormone-releasing hormone receptor found on pituitary somatotroph cells. Activation of that receptor triggers growth hormone release through a cyclic AMP dependent pathway.