CJC-1295 is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-07-22. Where a claim depends on a specific study, the study is described rather than over-claimed.
CJC-1295 is a synthetic peptide belonging to the growth hormone-releasing hormone analog family. It comprises twenty-nine amino acid residues derived from the N-terminal region of natural GHRH. The molecule incorporates several non-natural substitutions that increase resistance to enzymatic degradation. These modifications extend its activity compared with the native hormone fragment. Researchers use it to study pituitary growth hormone secretion in laboratory and clinical settings. This compound is distinct from native GHRH in its stability profile.
Two principal forms appear in the literature and in research supply. One carries a drug affinity complex, a maleimide-based group that forms a covalent bond with circulating albumin. This linkage slows clearance and produces a long-lasting elevation of peptide levels. The other form lacks that group and is often labeled MOD GRF(1-29). It has a much shorter circulation time. Both variants retain the same core receptor-binding sequence. Reported half-lives differ substantially between the two.
At the pituitary, the peptide binds the growth hormone-releasing hormone receptor on somatotroph cells. Receptor activation raises intracellular cyclic AMP and triggers release of stored growth hormone. Somatostatin and other hypothalamic signals modulate this response. Negative feedback from insulin-like growth factor 1 also influences output. The same regulatory architecture operates with the native hormone. Whether the synthetic analog alters feedback dynamics over repeated exposure remains an open question. Most published receptor work uses cell models rather than intact human systems.
Two related forms circulate in technical discussion under the same family name. The original version carries a drug affinity complex (DAC) that binds covalently to serum albumin after administration, and this linkage substantially extends circulation time. A second form, frequently written as modified GRF(1-29) or CJC-1295 without DAC, lacks that linker and clears much faster. The naming is a frequent source of confusion because the shorthand CJC-1295 can refer to either form depending on the source. Reports sometimes fail to specify which variant was studied.
The peptide backbone includes a D-alanine at position two, which resists cleavage by dipeptidyl peptidase IV, and several other substitutions that reduce degradation. Its molecular weight is roughly 3.4 kDa without the linker and about 3.6 kDa with it. The molecule is water soluble and is normally supplied as a lyophilized powder. Precise sequence and mass values depend on which variant is described, so technical documents usually state the exact form being referenced.
CJC-1295 is a synthetic peptide designed as a long-acting analogue of growth hormone-releasing hormone (GHRH). Its structure derives from the first 29 amino acids of native GHRH, a fragment often called GRF(1-29). Four substitutions were introduced to slow enzymatic breakdown and extend activity relative to the natural sequence. The compound was developed by ConjuChem as part of a broader effort to improve the pharmacokinetic profile of peptide hormones. It is studied in laboratory and clinical research settings rather than appearing as a naturally occurring substance.
| Property | Value | Notes |
|---|---|---|
| Molecular weight, DAC form | About 3647 Da | Varies with salt form |
| Molecular weight, non-DAC form | About 3358 Da | MOD GRF(1-29) |
| Solubility class | Water soluble | Also dissolves in polar solvents |
| Reported half-life, DAC form | About five to eight days | Values from human studies |
| Common synonyms | CJC-1295; MOD GRF(1-29) | Name depends on variant |
Reports on this compound commonly follow serum growth hormone and insulin-like growth factor 1 across defined time windows. Protocols differ in sampling frequency, assay platform, and participant characteristics, which makes direct comparison between publications difficult. Some work focuses on pulsatile release patterns instead of average concentrations. Whether repeated exposure alters endogenous hormone rhythms over long periods remains an open question, and the formal literature is thinner than the volume of informal commentary implies.
Once in circulation, the peptide binds the growth hormone-releasing hormone receptor displayed on pituitary somatotroph cells. Receptor activation couples to Gs proteins, elevates intracellular cyclic AMP, and drives protein kinase A signaling inside the cell. That cascade increases discharge of growth hormone into the bloodstream. The analog therefore operates through a receptor pathway that already exists for the body's own releasing hormone, rather than through an engineered artificial target.
Clearance profiles diverge sharply between the two versions. The albumin-binding molecule stays in plasma for several days, whereas the unmodified analog is largely gone within about half an hour in reported work. Cleavage by dipeptidyl peptidase IV is a major contributor to the short life of the unmodified sequence. These gaps mean the two versions cannot be substituted for each other in study design or in reading results side by side.
Downstream of growth hormone, the liver and other tissues increase production of insulin-like growth factor 1, a mediator of many growth-promoting effects. Studies have documented elevated levels of both hormones after dosing, and the rise from the long-acting form persists longer than that produced by shorter-acting analogues. What remains unclear is whether sustained elevation of these markers translates into meaningful clinical benefit, and whether prolonged exposure carries risks that short trials could not detect.
CJC-1295 acts at the growth hormone-releasing hormone receptor, a G-protein-coupled receptor found on somatotroph cells in the anterior pituitary. Binding triggers a rise in cyclic AMP and calcium entry, which promotes release of stored growth hormone. Because the peptide mimics the body's own releasing hormone, it amplifies existing secretory pulses rather than driving continuous output. The size of the response therefore depends partly on the subject's own hormonal rhythm and feedback state.
=== Trypsin === While working in the laboratory of Max Bergmann at Rockefeller Institute, now Rockefeller University, Hofmann synthesized analogs of the amino acid lysine and proved that the enzyme trypsin cleaves linkages involving the carboxyl group of that amino acid.
=== Ultrasonography === On penile ultrasonography, the typical appearance is hyperechoic focal thickening of the tunica albuginea. Due to associated calcifications, the imaging of patients with Peyronie's disease shows acoustic shadowing, as illustrated in figures below. Less common findings, attributed to earlier stages of the disease (still mild fibrosis), are hypoechoic lesions with focal thickening of the paracavernous tissues, echoic focal thickening of the tunica without posterior acoustic shadowing, retractile isoechoic lesions with posterior attenuation of the beam, and focal loss of the continuity of the tunica albuginea. In the doppler study, increased flow around the plaques can suggest inflammatory activity and the absence of flow can suggest disease stability. Ultrasound is useful for the identification of lesions and to determine their relationship with the neurovascular bundle. Individuals with Peyronie's disease can present with erectile dysfunction, often related to venous leakage, due to insufficient drainage at the site of the plaque. Although plaques are more common on the dorsum of the penis, they can also be seen on the ventral face, lateral face, or septum.
== Work history == While researching at Case Western Reserve, Tippett moonlighted as an emergency room physician and instructor in Emergency and Outpatient Medicine. He spent much of his early clinical career (1989–1995) in Emergency Medicine in Ohio and California. He received his board certification in Internal Medicine in 1987. Between 1993 and 2000, he served on the board of the Computer Ethics Institute. He served as executive director of The Pacific Foundation for Science and Medicine from 1988 to 1992, an intersection of his clinical career with an emerging focus on technology, particularly cybersecurity, and the use and access protocols of the Internet. It was in his role as president and chairman of Certus International, a publisher and developer of PC anti-virus and security software, that Tippett applied his research insights as a biochemist to the concept of computer "viruses" to develop the anti-virus software, "Vaccine," which was later purchased by Symantec in 1992. His CEO role with Cybertrust led to a merger of Cybertrust by Verizon, and Tippett's role in the Verizon healthcare and security innovations divisions. Tippett served as chairman of the Alliance for Internet Security in 2000. He represented Verizon on the board of directors of The Open Identity Exchange (OIX) and the Information Card Foundation.
These decrees were described by historian Paul Ginsborg as “the only attempt made by leftist government officials to advance on the path of reform”. Gullo, who became “Minister of the Peasants”, achieved two important results: the southern peasants' became aware of the state's support and the laborers' realization that uniting in cooperatives brought them power. Thanks in part to cooperation with trade unions, especially Giuseppe Di Vittorio's Italian General Confederation of Labour, Gullo's reform efforts were extended with two other decrees. One modified the taxable labor rate. Trade unions were empowered to dictate the number of laborers on a landowner's farmland. The latter allowed trade unionists to manage the labor placements according to seniority. With these measures they prevented war and brought the union onto the side of the peasants. The Gullo decrees were opposed by the agrarians, using the organized underworld and by enlisting the support the more conservative of the Christian Democrats (CD), who were against the revolutionary government measures. Local Christian Democrats were often involved with the past regime. They succeeded in amending the decrees with provisions that made them unenforceable. Instead, agricultural cooperatives received uncultivated land from a special provincial commission, composed of the president of the Court of Appeals, one representative of the agrarians and one representative of the peasants.
Sources: en.wikipedia.org
== Figurative use == The term poison is also used in a figurative sense. The slang sense of alcoholic drink is first attested 1805, American English (e.g., a bartender might ask a customer "what's your poison?" or "Pick your poison"). Figurative use of the term dates from the late 15th century. Figuratively referring to persons as poison dates from 1910. The figurative term poison pen letter became well known in 1913 by a notorious criminal case in Pennsylvania, U.S.; the phrase dates to 1898. Despite the plants of the Toxicodendron family having the names poison ivy and poison oak, the oil urushiol they produce is not a true poison and is actually an allergen, which 15% of people are resistant to.
Moscow, as the city designated by the Constitution of the Russian Federation as the seat of federal authority, contains the country's federal legislative, executive, and judicial authorities—except for the Constitutional Court of the Russian Federation, which has been located in Saint Petersburg since 2008. The supreme executive authority—the Government of the Russian Federation—is located in the House of the Government of the Russian Federation (the White House) on the Krasnopresnenskaya Embankment in the center of Moscow. The State Duma is on Okhotny Ryad (street). The Federation Council is in a building on Bolshaya Dmitrovka (street). The Supreme Court of the Russian Federation is also in Moscow. The Moscow Kremlin is the official residence of the President of the Russian Federation. The president's working residence in the Kremlin is located in the Senate Palace.
=== Risk of forgoing conventional medical care === As with other alternative medicines, unethical or naïve practitioners may induce patients to exhaust financial resources by pursuing ineffective treatment. Professional ethics codes set by accrediting organizations such as the National Certification Commission for Acupuncture and Oriental Medicine require practitioners to make "timely referrals to other health care professionals as may be appropriate." Stephen Barrett states that there is a "risk that an acupuncturist whose approach to diagnosis is not based on scientific concepts will fail to diagnose a dangerous condition".
TATP decomposes explosively; examination of the explosive decomposition of TATP at the very edge of detonation front predicts "formation of acetone and ozone as the main decomposition products and not the intuitively expected oxidation products." Very little heat is created by the explosive decomposition of TATP at the very edge of the detonation front; the foregoing computational analysis suggests that TATP decomposition is an entropic explosion. However, this hypothesis has been challenged as not conforming to actual measurements. The claim of entropic explosion has been tied to the events just behind the detonation front. The authors of the 2004 Dubnikova et al. study confirm that a final redox reaction (combustion) of ozone, oxygen and reactive species into water, various oxides and hydrocarbons takes place within about 180 ps after the initial reaction—within about a micron of the detonation wave. Detonating crystals of TATP ultimately reach temperature of 2,300 K (2,030 °C; 3,680 °F) and pressure of 80 kbar. The final energy of detonation is about 2800 kJ/kg (measured in helium), enough to briefly raise the temperature of gaseous products to 2,000 °C (3,630 °F). Volume of gases at STP is 855 L/kg for TATP and 713 L/kg for DADP (measured in helium). The tetrameric form of acetone peroxide, prepared under neutral conditions using a tin catalyst in the presence of a chelator or general inhibitor of radical chemistry, is reported to be more chemically stable, although still a very dangerous primary explosive. Its synthesis has been disputed.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
It is a synthetic peptide modeled on growth hormone-releasing hormone. The molecule is used in research on pituitary growth hormone secretion. It differs from the natural hormone through several stabilizing substitutions.
The DAC form carries a maleimide group that binds albumin and extends circulation time. The non-DAC form lacks this group and clears much faster. Both share the same receptor-binding core.
It targets the growth hormone-releasing hormone receptor on pituitary somatotroph cells. Activation raises cyclic AMP and promotes growth hormone release. Normal feedback pathways remain part of the response.
No. It is a synthetic analogue modeled on the first 29 residues of human GHRH. The substitutions and any linker are laboratory modifications rather than features of the endogenous peptide.